Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pyrococcus kodakaraensis UPF0290 protein TK2119 (TK2119)

This Recombinant Pyrococcus kodakaraensis UPF0290 protein TK2119 (TK2119) spans the amino acid sequence from region 1-171.

Product Specifications

Product Name Alternative

UPF0290 protein TK2119

UniProt

Q5JEX0

Expression Region

1-171

Origin

Pyrococcus kodakaraensis (strain ATCC BAA-918 / JCM 12380 / KOD1) (Thermococcus kodakaraensis (strain KOD1) )

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGWLSSIFWAFWYILPAYFANASPVLVGGGRPIDGGRVWRDGRRLLGDGKTWRGFIGGVL IGTLVGIVQYFITPDFYGSLETAVKLAFLLSFGALIGDLVGSFIKRRANLPRGYPAIGLD QLGFLISALAFAYPVKTLSSGQIIFLLVVSPFIHWGANYFAYRMGWKSVPW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cellocidin
562737 10.0mg

Cellocidin

Sign In for Pricing
View Details
Research Grade Ziltivekimab
DHC15802 100 μg

Research Grade Ziltivekimab

Sign In for Pricing
View Details
PerCP anti-mouse CD5
GT00241 25 µg

PerCP anti-mouse CD5

Sign In for Pricing
View Details
LCN6 AAV Vector (Human) (CMV)
26388101 1 µg

LCN6 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
KIF19 (NM_153209) Human Over-expression Lysate
LY407138 100 µg

KIF19 (NM_153209) Human Over-expression Lysate

Sign In for Pricing
View Details
DPPA2P1 Protein Vector (Human) (pPB-N-His)
PV073978 500 ng

DPPA2P1 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details