Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Probable tryptophan transport protein (trpP)

This Recombinant Bacillus subtilis Probable tryptophan transport protein (trpP) spans the amino acid sequence from region 1-172.

Product Specifications

Product Name Alternative

Probable tryptophan transport protein

UniProt

O07515

Expression Region

1-172

Origin

Bacillus subtilis (strain 168)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKTKELVIMALFAAIGAALHSIIPPFLGGMKPDMMLIMMFMGILLFPRVQNVLVIGIVTG IISALTTAFPAGQIPNIIDKPVSAFLFFSLFLLFRKSRKTGAAAVLTVIGTILSGIVFLS SALLIVGLPGGFAALFAAVVLPAAVLNTISMIIIYPIVQTILRRSSFMEAAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TCF25 Polyclonal Antibody
RD266435A-01 60 μL

TCF25 Polyclonal Antibody

Sign In for Pricing
View Details
TCF25 Polyclonal Antibody
RD266435A-02 120 μL

TCF25 Polyclonal Antibody

Sign In for Pricing
View Details
TCF25 Polyclonal Antibody
RD266435A-03 200 µL

TCF25 Polyclonal Antibody

Sign In for Pricing
View Details
PRNP Antibody, FITC conjugated
A32063-100UG 100 µg

PRNP Antibody, FITC conjugated

Sign In for Pricing
View Details
ZDHHC11 Antibody
orb1558298-01 50 μL

ZDHHC11 Antibody

Sign In for Pricing
View Details
ZDHHC11 Antibody
orb1558298-02 100 µL

ZDHHC11 Antibody

Sign In for Pricing
View Details