Recombinant Cytochrome c oxidase subunit 1 (COX1)
This Recombinant Cytochrome c oxidase subunit 1 (COX1) spans the amino acid sequence from region 1-172.
Product Specifications
Product Name Alternative
Cytochrome c oxidase subunit 1, EC= 1.9.3.1, Cytochrome c oxidase polypeptide I
UniProt
Q33439
Expression Region
1-172
Origin
Ephedra equisetifolia
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
GAITMLLTDRNFNTTFFDPAGGGDPILYQHLFWFFGHPEVYILILPGFGIISQIVSTLSG KQVFGYLGMVYAMISIGVLGFMVWAHHMFTVGLDVDTRAYFTAATMIIAVPTGIKIFSWI ATMWGGSIRSITPMLFAVGFLFLFTIGGLTGIVLANSGLDIALHDTYYVVAH
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC880149-500 1x 500 µL
CD106 / VCAM1 (1.4C3), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940679-100 1x 100 µL
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC682103-100 1x 100 µL
Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2103R), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC942123-100 1x 100 µL
Mammaglobin (SCGB2A2) (Breast Cancer Marker) (MGB1/2123R), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740979-100 1x 100 µL
Cytokeratin 8/18 (KRT8/803 + KRT18/835), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details