Recombinant Xanthomonas campestris pv. campestris Disulfide bond formation protein B (dsbB)
This Recombinant Xanthomonas campestris pv. campestris Disulfide bond formation protein B (dsbB) spans the amino acid sequence from region 1-172.
Product Specifications
Product Name Alternative
Disulfide bond formation protein B, Disulfide oxidoreductase
UniProt
Q4URG5
Expression Region
1-172
Origin
Xanthomonas campestris pv. campestris (strain 8004)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MNPFRWGFRAQFLLGFLACAGLLAYAIYVQLHLGLEPCPLCIFQRIAFATLALLFLLGAL HGPRGAGGRKAYGVLAFIAAGVGMGIAARHVWVQIRPKDMMSSCGPPLSFLSETMGPFEV FRTVLTGTGDCGNIDWRFLGLSMPMWSMVWFVGLALWALYAGFKHRGPRKLF
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470177-100 1x 100 µL
CD50 (ICAM-3) (101-1D2), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040181-500 1x 500 µL
CD59 (heavy chain of Protectin) (BRA-10G), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC471003-500 1x 500 µL
Mucin 5AC (MUC5AC) (58M1), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC941820-500 1x 500 µL
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400352-100 1x 100 µL
CD31 / PECAM-1 (158-2B3), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details