Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xanthomonas axonopodis pv. citri Disulfide bond formation protein B (dsbB)

This Recombinant Xanthomonas axonopodis pv. citri Disulfide bond formation protein B (dsbB) spans the amino acid sequence from region 1-172.

Product Specifications

Product Name Alternative

Disulfide bond formation protein B, Disulfide oxidoreductase

UniProt

Q8PNQ6

Expression Region

1-172

Origin

Xanthomonas axonopodis pv. citri (strain 306)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPFRWSFRAQFLLGFLACAGLLAYAIYVQLHLGLEPCPLCIFQRIAFAALAVFFLLGAL HGPRAAAGRKVYGVLSFIAAGVGMGIAARHVWVQIRPKDMMSSCGPPLSFLSETMGPFEV FRTVLTGTGDCGNIDWRFLGLSMPMWSMVWFVGLALWALYAGFKVRRSSVHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD53 (161-2), CF488A conjugate, 0.1mg/mL
BNC880324-500 1x 500 µL

CD53 (161-2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF568 conjugate, 0.1mg/mL
BNC680345-500 1x 500 µL

CD4 (EDU-2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11a (Cris-3), CF594 conjugate, 0.1mg/mL
BNC940151-100 1x 100 µL

CD11a (Cris-3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase (T311), CF740 conjugate, 0.1mg/mL
BNC740012-100 1x 100 µL

Tyrosinase (T311), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (IAP/964), CF640R conjugate, 0.1mg/mL
BNC400964-500 1x 500 µL

CD47 (IAP/964), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD19 (CVID3/155), CF405S conjugate, 0.1mg/mL
BNC040155-500 1x 500 µL

CD19 (CVID3/155), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details