Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Epithelial membrane protein 2 (Emp2)

This Recombinant Mouse Epithelial membrane protein 2 (Emp2) spans the amino acid sequence from region 1-172.

Product Specifications

Product Name Alternative

Epithelial membrane protein 2, EMP-2, Protein XMP

UniProt

O88662

Expression Region

1-172

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLVILAFIIVFHIVSTALLFISTIDNAWWVGDSFSADLWRVCTNSTNCTEINELTGPEAF EGYSVMQAVQATMILSTILSCISFLIFLLQLFRLKQGERFVLTSIIQLMSCLCVMIGASI YTDRRQDLHQQNRKLYYLLQEGSYGYSFILAWVAFAFTFISGLMYMILRKRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cathepsin D (Tumor Marker) (CTSD/3083), CF640R conjugate, 0.1mg/mL
BNC403083-100 1x 100 µL

Cathepsin D (Tumor Marker) (CTSD/3083), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EPPK1 Human Gene Knockout Kit (CRISPR)
KN212630LP 1 Kit

EPPK1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human EXTL3 activation kit by CRISPRa
GA101489 1 Kit

Human EXTL3 activation kit by CRISPRa

Sign In for Pricing
View Details
MAG Recombinant Chimeric Antibody Antibody
HA610340 100 µL

MAG Recombinant Chimeric Antibody Antibody

Sign In for Pricing
View Details
TentaGel® MB RAM
MB160230.1G 1 g

TentaGel® MB RAM

Sign In for Pricing
View Details
Rsu1 Mouse Gene Knockout Kit (CRISPR)
KN515177 1 Kit

Rsu1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details