Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Rod shape-determining protein mreD (mreD)

This Recombinant Bacillus subtilis Rod shape-determining protein mreD (mreD) spans the amino acid sequence from region 1-172.

Product Specifications

Product Name Alternative

Rod shape-determining protein mreD

UniProt

Q01467

Expression Region

1-172

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKRFLLPFVMMLVFSAESIFTDLVHFPFVTDDQVLAPRFLMLVLIFMSAFINQKHAMIYG FIFGFLYDMNYTSLLGVYMFGFAGLCYLASKAFKVLHTNAFVVILIAVLAVCLLEFYVFG IQSLIHKDIMTFNGFVLDRFIPTILLNIAAALILVLPFRLFFMSLKKELRDE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Steviol Acyl Glucuronide Potassium Salt
TRC-S686728-5MG 5 mg

Steviol Acyl Glucuronide Potassium Salt

Sign In for Pricing
View Details
Recombinant Histone H3 Antibody
RC-16776-01 50 μL

Recombinant Histone H3 Antibody

Sign In for Pricing
View Details
Recombinant Histone H3 Antibody
RC-16776-02 100 µL

Recombinant Histone H3 Antibody

Sign In for Pricing
View Details
Recombinant Histone H3 Antibody
RC-16776-03 1 mL

Recombinant Histone H3 Antibody

Sign In for Pricing
View Details
2-Hydroxy-3-cyanopyridine
TRC-H825140-500MG 500 mg

2-Hydroxy-3-cyanopyridine

Sign In for Pricing
View Details
Recombinant JNK Monoclonal Antibody
E-AB-81448-01 50 µL

Recombinant JNK Monoclonal Antibody

Sign In for Pricing
View Details