Recombinant Bacillus subtilis Rod shape-determining protein mreD (mreD)
This Recombinant Bacillus subtilis Rod shape-determining protein mreD (mreD) spans the amino acid sequence from region 1-172.
Product Specifications
Product Name Alternative
Rod shape-determining protein mreD
UniProt
Q01467
Expression Region
1-172
Origin
Bacillus subtilis (strain 168)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MKRFLLPFVMMLVFSAESIFTDLVHFPFVTDDQVLAPRFLMLVLIFMSAFINQKHAMIYG FIFGFLYDMNYTSLLGVYMFGFAGLCYLASKAFKVLHTNAFVVILIAVLAVCLLEFYVFG IQSLIHKDIMTFNGFVLDRFIPTILLNIAAALILVLPFRLFFMSLKKELRDE
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC402278-500 1x 500 µL
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/2278R), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
HA710135 100 µg
Mouse IgG2b (Fcγ Fragment specific), AlpHcAbs® Goat antibody
Sign In for Pricing
View Details 
BNC743416-100 1x 100 µL
GP2 (Glycoprotein 2) / ZAP75 (GP2/3416), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details