Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Aspergillus oryzae Protein sym1 (sym1)

This Recombinant Aspergillus oryzae Protein sym1 (sym1) spans the amino acid sequence from region 1-173.

Product Specifications

Product Name Alternative

Protein sym1

UniProt

Q2TXA2

Expression Region

1-173

Origin

Aspergillus oryzae (strain ATCC 42149 / RIB 40) (Yellow koji mold)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFRWYQAKLAKQPILTASVTSAVLFGSGDVLAQQVVDRKGLEKHDFARTGRMALYGGAIF GPAATTWFGFLQRNVVLKNSKATIVARVAADQCLFTPTHLTCFLTSMAIMEGSDPIEKWR NSFLPSYKANLTIWPLVQGVNFSIVPLEYRVLVVNLVSLGWNCLLSMINSGDK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNFAIP8 Polyclonal Antibody
E-AB-17125-01 20 µL

TNFAIP8 Polyclonal Antibody

Sign In for Pricing
View Details
TNFAIP8 Polyclonal Antibody
E-AB-17125-02 60 µL

TNFAIP8 Polyclonal Antibody

Sign In for Pricing
View Details
TNFAIP8 Polyclonal Antibody
E-AB-17125-03 120 µL

TNFAIP8 Polyclonal Antibody

Sign In for Pricing
View Details
TNFAIP8 Polyclonal Antibody
E-AB-17125-04 200 µL

TNFAIP8 Polyclonal Antibody

Sign In for Pricing
View Details
(S)-(-)-1,2,4-Butanetriol
TRC-B808700-2.5G 2.5 g

(S)-(-)-1,2,4-Butanetriol

Sign In for Pricing
View Details
Emerin (Papillary Thyroid Carcinoma and EDMD Marker) (EMD/2167), CF568 conjugate, 0.1mg/mL
BNC682167-500 1x 500 µL

Emerin (Papillary Thyroid Carcinoma and EDMD Marker) (EMD/2167), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details