Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Aspergillus oryzae Protein sym1 (sym1)

This Recombinant Aspergillus oryzae Protein sym1 (sym1) spans the amino acid sequence from region 1-173.

Product Specifications

Product Name Alternative

Protein sym1

UniProt

Q2TXA2

Expression Region

1-173

Origin

Aspergillus oryzae (strain ATCC 42149 / RIB 40) (Yellow koji mold)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFRWYQAKLAKQPILTASVTSAVLFGSGDVLAQQVVDRKGLEKHDFARTGRMALYGGAIF GPAATTWFGFLQRNVVLKNSKATIVARVAADQCLFTPTHLTCFLTSMAIMEGSDPIEKWR NSFLPSYKANLTIWPLVQGVNFSIVPLEYRVLVVNLVSLGWNCLLSMINSGDK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

alpha-D-Maltose Octaacetate
TRC-M158500-500MG 500 mg

alpha-D-Maltose Octaacetate

Sign In for Pricing
View Details
NY-ESO-1 (CTAG1B) Human Gene Knockout Kit (CRISPR)
KN213318 1 Kit

NY-ESO-1 (CTAG1B) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
LIPI Antibody
8C16481-AAT 50 µg

LIPI Antibody

Sign In for Pricing
View Details
E74 like factor 1 (ELF1) Mouse Monoclonal Antibody [Clone ID: OTI2G9]
CF811234 100 µg

E74 like factor 1 (ELF1) Mouse Monoclonal Antibody [Clone ID: OTI2G9]

Sign In for Pricing
View Details
IRAK1BP1 (NM_001010844) Human Over-expression Lysate
LY423178 100 µg

IRAK1BP1 (NM_001010844) Human Over-expression Lysate

Sign In for Pricing
View Details
Integrin alpha-2 Antibody (Biotin)
KB-3664-01 50 μL

Integrin alpha-2 Antibody (Biotin)

Sign In for Pricing
View Details