Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse MARVEL domain-containing protein 1 (Marveld1)

This Recombinant Mouse MARVEL domain-containing protein 1 (Marveld1) spans the amino acid sequence from region 1-173.

Product Specifications

Product Name Alternative

MARVEL domain-containing protein 1

UniProt

Q7TQJ1

Expression Region

1-173

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLPPPPRQPPPQARTARGSLRLQRAFLRGPLGVLRLLQLLAGAAFWITIATSKYQGPVHF ALFVSVLFWLLTLGLYFITLLGKQELVPVLGSRWLVVNVAHDLLAAALYGAATGIMIDQT QRHSYCNLKNYRLPCAYHAFLAASVCGGLCLGLYLLSALYGCCRRYQGKEEVV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Apoptosis repressor with CARD (NOL3) Human Gene Knockout Kit (CRISPR)
KN400591 1 Kit

Apoptosis repressor with CARD (NOL3) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human Neuropeptide Y Receptor Y1 (NPY1R) ELISA Kit
RD-NPY1R-Hu-01 96 Tests

Human Neuropeptide Y Receptor Y1 (NPY1R) ELISA Kit

Sign In for Pricing
View Details
Human Neuropeptide Y Receptor Y1 (NPY1R) ELISA Kit
RD-NPY1R-Hu-02 48 Tests

Human Neuropeptide Y Receptor Y1 (NPY1R) ELISA Kit

Sign In for Pricing
View Details
Human MAL2 activation kit by CRISPRa
GA114437 1 Kit

Human MAL2 activation kit by CRISPRa

Sign In for Pricing
View Details
Human CLIP4 activation kit by CRISPRa
GA112596 1 Kit

Human CLIP4 activation kit by CRISPRa

Sign In for Pricing
View Details
S100A1 (C-term) Rabbit Polyclonal Antibody
AP53776PU-N 400 µL

S100A1 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details