Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse MARVEL domain-containing protein 1 (Marveld1)

This Recombinant Mouse MARVEL domain-containing protein 1 (Marveld1) spans the amino acid sequence from region 1-173.

Product Specifications

Product Name Alternative

MARVEL domain-containing protein 1

UniProt

Q7TQJ1

Expression Region

1-173

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLPPPPRQPPPQARTARGSLRLQRAFLRGPLGVLRLLQLLAGAAFWITIATSKYQGPVHF ALFVSVLFWLLTLGLYFITLLGKQELVPVLGSRWLVVNVAHDLLAAALYGAATGIMIDQT QRHSYCNLKNYRLPCAYHAFLAASVCGGLCLGLYLLSALYGCCRRYQGKEEVV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-KIF4A/4B Antibody Picoband® Fluoro594 Conjugated
A04486-1-Fluoro594 100 µg/Vial

Anti-KIF4A/4B Antibody Picoband® Fluoro594 Conjugated

Sign In for Pricing
View Details
CCL26 Rabbit Polyclonal Antibody (BF750)
orb1601194 100 µL

CCL26 Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details
Fbxw28 Protein Vector (Mouse) (pPB-C-His)
PV178866 500 ng

Fbxw28 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Src Antibody
RQ5396 100 µL

Src Antibody

Sign In for Pricing
View Details
Fish Thyroxine, T4 ELISA KIT
CK-bio-19079-01 48 Tests

Fish Thyroxine, T4 ELISA KIT

Sign In for Pricing
View Details
Fish Thyroxine, T4 ELISA KIT
CK-bio-19079-02 96 Tests

Fish Thyroxine, T4 ELISA KIT

Sign In for Pricing
View Details