Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse CKLF-like MARVEL transmembrane domain-containing protein 8 (Cmtm8)

This Recombinant Mouse CKLF-like MARVEL transmembrane domain-containing protein 8 (Cmtm8) spans the amino acid sequence from region 1-173.

Product Specifications

Product Name Alternative

CKLF-like MARVEL transmembrane domain-containing protein 8, Chemokine-like factor superfamily member 8

UniProt

Q9CZR4

Expression Region

1-173

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEEQQRARSHTVTTTTSSFAENFSTTSSSFAYDREFLRTPPGLLIVAEIVLGLLVWTLIA GTEYFRVPAFGWVMFVAVFYWVLTVFFLIVYITLTYTRIPQVPWTTVGLCFNGSAFVLYF SAAIVDASSVSPEKEGHNFNSWAASSFFAFLVTICYAGNTYFSFIAWRSRTAQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PARK7 (NM_001123377) Human Over-expression Lysate
LC426614 20 µg

PARK7 (NM_001123377) Human Over-expression Lysate

Sign In for Pricing
View Details
Moxidectin O-TBS
TRC-M744820-50MG 50 mg

Moxidectin O-TBS

Sign In for Pricing
View Details
PKC θ (Ab-676) Antibody
8B7197-AAT 50 µg

PKC θ (Ab-676) Antibody

Sign In for Pricing
View Details
D-Mannuronic Acid Sodium Salt
TRC-D208470-250MG 250 mg

D-Mannuronic Acid Sodium Salt

Sign In for Pricing
View Details
Human DNA polymerase alpha (POLA1) activation kit by CRISPRa
GA103645 1 Kit

Human DNA polymerase alpha (POLA1) activation kit by CRISPRa

Sign In for Pricing
View Details
NCALD (NM_001040629) Human Recombinant Protein
TP318434M 100 µg

NCALD (NM_001040629) Human Recombinant Protein

Sign In for Pricing
View Details