Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse CKLF-like MARVEL transmembrane domain-containing protein 8 (Cmtm8)

This Recombinant Mouse CKLF-like MARVEL transmembrane domain-containing protein 8 (Cmtm8) spans the amino acid sequence from region 1-173.

Product Specifications

Product Name Alternative

CKLF-like MARVEL transmembrane domain-containing protein 8, Chemokine-like factor superfamily member 8

UniProt

Q9CZR4

Expression Region

1-173

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEEQQRARSHTVTTTTSSFAENFSTTSSSFAYDREFLRTPPGLLIVAEIVLGLLVWTLIA GTEYFRVPAFGWVMFVAVFYWVLTVFFLIVYITLTYTRIPQVPWTTVGLCFNGSAFVLYF SAAIVDASSVSPEKEGHNFNSWAASSFFAFLVTICYAGNTYFSFIAWRSRTAQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SOX10 (SOX10/991 + SOX10/1074), Biotin conjugate, 0.1mg/mL
BNCB1074-500 1x 500 µL

SOX10 (SOX10/991 + SOX10/1074), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IFABP/FABP2 Antibody Pair Set
E-KAB-0034 50 µL & 100 µg

Human IFABP/FABP2 Antibody Pair Set

Sign In for Pricing
View Details
(Ac-LEHD) 2-R110
13427-AAT 1 mg

(Ac-LEHD) 2-R110

Sign In for Pricing
View Details
ZNF704 (NM_001033723) Human Recombinant Protein
TP312004 20 µg

ZNF704 (NM_001033723) Human Recombinant Protein

Sign In for Pricing
View Details
Ephrin A3 (EFNA3) Rabbit Polyclonal Antibody
AP20385PU-N 100 µg

Ephrin A3 (EFNA3) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RANBP1 Rabbit Polyclonal Antibody
TA380698 100 µL

RANBP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details