Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Disulfide bond formation protein B (dsbB)

This Recombinant Disulfide bond formation protein B (dsbB) spans the amino acid sequence from region 1-173.

Product Specifications

Product Name Alternative

Disulfide bond formation protein B, Disulfide oxidoreductase

UniProt

Q9PGG2

Expression Region

1-173

Origin

Xylella fastidiosa

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNALQWSFRAQCLTGFLFCTGLLAYAIFLQLHQGLEPCPLCIFQRIAFAVLGILFLIAGL YNSSNVYTRKAYGLLIFLTAAIGTGIAGRHVWVQLMPHNTISSCGSPLSFLSETMGPFEV FRTVLTGTSDCGNIDWRFLGLSMPMWSMFWFVALALLGLLVGFKAERRKPLFS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Carboxyisothiazole
MBS5751215 Inquire

4-Carboxyisothiazole

Sign In for Pricing
View Details
SLC29A4 Polyclonal Antibody, FITC Conjugated
bs-4176R-FITC 100 µL

SLC29A4 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
GABRR2 siRNA (Human)
orb1866550-01 15 nmol

GABRR2 siRNA (Human)

Sign In for Pricing
View Details
GABRR2 siRNA (Human)
orb1866550-02 30 nmol

GABRR2 siRNA (Human)

Sign In for Pricing
View Details
Human Angiotensin I Converting Enzyme 2 (ACE2) ELISA Kit
EIA07649h 1 Kit

Human Angiotensin I Converting Enzyme 2 (ACE2) ELISA Kit

Sign In for Pricing
View Details
CEBP alpha Recombinant Protein Antigen
NBP2-56909PEP 100 µL

CEBP alpha Recombinant Protein Antigen

Sign In for Pricing
View Details