Recombinant Disulfide bond formation protein B (dsbB)
This Recombinant Disulfide bond formation protein B (dsbB) spans the amino acid sequence from region 1-173.
Product Specifications
Product Name Alternative
Disulfide bond formation protein B, Disulfide oxidoreductase
UniProt
Q9PGG2
Expression Region
1-173
Origin
Xylella fastidiosa
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MNALQWSFRAQCLTGFLFCTGLLAYAIFLQLHQGLEPCPLCIFQRIAFAVLGILFLIAGL YNSSNVYTRKAYGLLIFLTAAIGTGIAGRHVWVQLMPHNTISSCGSPLSFLSETMGPFEV FRTVLTGTSDCGNIDWRFLGLSMPMWSMFWFVALALLGLLVGFKAERRKPLFS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
PC1005837-01 1 g
Rel- (1r,1'r,4R,4'R) -4- (difluoro (3,4,5-trifluorophenoxy) methyl) -4'-ethyl-1,1'-bi (cyclohexane)
Sign In for Pricing
View Details PC1005837-02 5 g
Rel- (1r,1'r,4R,4'R) -4- (difluoro (3,4,5-trifluorophenoxy) methyl) -4'-ethyl-1,1'-bi (cyclohexane)
Sign In for Pricing
View Details PC1005837-03 25 g
Rel- (1r,1'r,4R,4'R) -4- (difluoro (3,4,5-trifluorophenoxy) methyl) -4'-ethyl-1,1'-bi (cyclohexane)
Sign In for Pricing
View Details MBS6506040-01 0.2 mL
WISP3, ID (WNT1-inducible-signaling Pathway Protein 3, WISP-3, CCN Family Member 6, CCN6, UNQ462/PRO790/PRO956) (FITC)
Sign In for Pricing
View Details