Recombinant Escherichia coli Inner membrane protein ybcI (ybcI)
This Recombinant Escherichia coli Inner membrane protein ybcI (ybcI) spans the amino acid sequence from region 1-173.
Product Specifications
Product Name Alternative
Inner membrane protein ybcI
UniProt
P45570
Expression Region
1-173
Origin
Escherichia coli (strain K12)
Field of Research
Infectious Disease & Virology; Cell Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MPTVITHAAVPLCIGLGLGSKVIPPRLLFAGIILAMLPDADVLSFKFGVAYGNVFGHRGF THSLVFAFVVPLLCVFIGRRWFRAGLIRCWLFLTVSLLSHSLLDSVTTGGKGVGWLWPWS DERFFAPWQVIKVAPFALSRYTTPYGHQVIISELMWVWLPGMLLMGMLWWRRR
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC040003-100 1x 100 µL
CD45RO (UCHL-1), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC041081-100 1x 100 µL
CD45RO (190-2F2.5), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400009-500 1x 500 µL
MART-1 / Melan-A (M2-7C10), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400890-500 1x 500 µL
NGFR (Nerve Growth Factor Receptor) (NGFR5), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details