Recombinant Cupriavidus necator Lipoprotein signal peptidase (lspA)
This Recombinant Cupriavidus necator Lipoprotein signal peptidase (lspA) spans the amino acid sequence from region 1-175.
Product Specifications
Product Name Alternative
Lipoprotein signal peptidase, EC= 3.4.23.36, Prolipoprotein signal peptidase, Signal peptidase II, SPase II
UniProt
Q0K799
Expression Region
1-175
Origin
Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) (Ralstonia eutropha)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MASTTSRSARPARRNNKAASTTPLLWMAFALLVVVLDQFFKIVIVRTFTYGESRPVTGFF NLVLVYNKGAAFSFLADAGGWQRWFFTGLGIVVGAFIVWLLYRHTGQRLFCFAVSLILGG AVGNVIDRVVYGHVVDFLDFYVRNYHWPAFNVADCAITVGAVLLIVDELRRVRRH
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680225-500 1x 500 µL
Major Vault Protein (MVP) (1032), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880266-100 1x 100 µL
Human IgG Immunoglobulin (IG266), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC700745-100 1x 100 µL
CD45 / LCA (2B11 + PD7/26), CF770 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401003-100 1x 100 µL
Mucin 5AC (MUC5AC) (58M1), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details