Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acidianus two-tailed virus Putative transmembrane protein ORF175

This Recombinant Acidianus two-tailed virus Putative transmembrane protein ORF175 spans the amino acid sequence from region 1-175.

Product Specifications

Product Name Alternative

Putative transmembrane protein ORF175

UniProt

Q3V4W5

Expression Region

1-175

Origin

Acidianus two-tailed virus (ATV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLQTWAKLAYEANLGIVYGSTLIILLLPLIGSFMPPNLVSSISKLNAFTLLESYLLPVLS NFGIFGGLALGVGSAIAFSVLNSIASSFLNLSFNQQQALTIVVALLVSQFIFGGWATFAL FLTSMLGSVPPVPGLAVIMSFITPFIDGLIATLGGLMVVLSILYELSEIGLVTLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (B-B12), CF640R conjugate, 0.1mg/mL
BNC401052-100 1x 100 µL

CD3e (B-B12), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD16 (C16/1045), CF740 conjugate, 0.1mg/mL
BNC741045-500 1x 500 µL

CD16 (C16/1045), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF647 conjugate, 0.1mg/mL
BNC470003-500 1x 500 µL

CD45RO (UCHL-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF568 conjugate, 0.1mg/mL
BNC680342-500 1x 500 µL

CD43 (84-3C1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF594 conjugate, 0.1mg/mL
BNC941052-100 1x 100 µL

CD3e (B-B12), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD68 (C68/684 + KP1), CF740 conjugate, 0.1mg/mL
BNC740685-100 1x 100 µL

CD68 (C68/684 + KP1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details