Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Protein MAL2 (Mal2)

This Recombinant Mouse Protein MAL2 (Mal2) spans the amino acid sequence from region 1-175.

Product Specifications

Product Name Alternative

Protein MAL2

UniProt

Q8BI08

Expression Region

1-175

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSAGGAVPPPPNPAVSFPAPRVTLPAGPDILRTYSGAFVCLEIVLGGLVWILVASSNVPL PLLQGWVMFVSVTAFFFSLLFLGLFLSGMVTQIDANWNFLDFVYHFIVFVFYFGAFLLEA AATSLHDLQCNTTMTVKPLLNDNQYNINVAATVFAFMTTACYGCSLGLALRRWRP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Ras-related protein Rab-5C, Rab5c ELISA KIT
ELI-15070m 96 Tests

Mouse Ras-related protein Rab-5C, Rab5c ELISA KIT

Sign In for Pricing
View Details
Fibronectin (Cold insoluble globulin (CIG), FINC, FN1, FNZ, GFND, GFND2, LETS, Migration stimulating factor (MSF), Ugl-Y3) (FITC)
168773-AF-FITC 100 µL

Fibronectin (Cold insoluble globulin (CIG), FINC, FN1, FNZ, GFND, GFND2, LETS, Migration stimulating factor (MSF), Ugl-Y3) (FITC)

Sign In for Pricing
View Details
FFPM
MBS5773815-01 5 mg

FFPM

Sign In for Pricing
View Details
FFPM
MBS5773815-02 5x 5 mg

FFPM

Sign In for Pricing
View Details
Rabbit Anti-Human IgG F (ab') 2 - AF647
L35483 1 mL

Rabbit Anti-Human IgG F (ab') 2 - AF647

Sign In for Pricing
View Details
VEST1 CRISPR Activation Plasmid (m2)
sc-435771-ACT-2 20 µg

VEST1 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details