Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Protein MAL2 (Mal2)

This Recombinant Mouse Protein MAL2 (Mal2) spans the amino acid sequence from region 1-175.

Product Specifications

Product Name Alternative

Protein MAL2

UniProt

Q8BI08

Expression Region

1-175

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSAGGAVPPPPNPAVSFPAPRVTLPAGPDILRTYSGAFVCLEIVLGGLVWILVASSNVPL PLLQGWVMFVSVTAFFFSLLFLGLFLSGMVTQIDANWNFLDFVYHFIVFVFYFGAFLLEA AATSLHDLQCNTTMTVKPLLNDNQYNINVAATVFAFMTTACYGCSLGLALRRWRP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM126B Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV716042 1.0 µg DNA

TMEM126B Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Anti-Nitric Oxide Synthase (C-term), rabbit pab
16058 50 µL

Anti-Nitric Oxide Synthase (C-term), rabbit pab

Sign In for Pricing
View Details
Esculentic acid
MBS5762366 Inquire

Esculentic acid

Sign In for Pricing
View Details
Bestrophin 3 (BEST3) (NM_152439) Human Recombinant Protein
E45H35185M5 20 µg

Bestrophin 3 (BEST3) (NM_152439) Human Recombinant Protein

Sign In for Pricing
View Details
Human Casein kinase I isoform gamma 3 (CSNK1G3) ELISA Kit
GTR10369390 96 Well

Human Casein kinase I isoform gamma 3 (CSNK1G3) ELISA Kit

Sign In for Pricing
View Details
Mouse Growth Associated Protein 43 (GAP43) ELISA Kit
EK14174 48 Tests

Mouse Growth Associated Protein 43 (GAP43) ELISA Kit

Sign In for Pricing
View Details