Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Putative sugar uptake protein

This Recombinant Putative sugar uptake protein spans the amino acid sequence from region 1-176.

Product Specifications

Product Name Alternative

Putative sugar uptake protein

UniProt

P60950

Expression Region

1-176

Origin

Lactobacillus delbrueckii subsp. lactis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

IFGEWKTSNNFIFGIXALVIIMVGVIXTXYTEKGDGFTQKTTNKDILFLVLTTXGYLAYX AXPKTITADAESMFLPQTLGILLGSVIYLAFSGNKAAFKEKASYLDLFAGISFGIAAYAY IIXAQVNGVTNAFIYGQLSVIISTIGGMTLLGERKQGKELVATLAGLCLIVVGAIL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bile salt export pump
AP78770-01 50 µg

Bile salt export pump

Sign In for Pricing
View Details
Bile salt export pump
AP78770-02 100 µg

Bile salt export pump

Sign In for Pricing
View Details
Bile salt export pump
AP78770-03 1 mg

Bile salt export pump

Sign In for Pricing
View Details
Polyclonal Antibody to Connexin 43 (CX43)
MBS2027180-01 0.1 mL

Polyclonal Antibody to Connexin 43 (CX43)

Sign In for Pricing
View Details
Polyclonal Antibody to Connexin 43 (CX43)
MBS2027180-02 0.2 mL

Polyclonal Antibody to Connexin 43 (CX43)

Sign In for Pricing
View Details
Polyclonal Antibody to Connexin 43 (CX43)
MBS2027180-03 0.5 mL

Polyclonal Antibody to Connexin 43 (CX43)

Sign In for Pricing
View Details