Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Putative sugar uptake protein

This Recombinant Putative sugar uptake protein spans the amino acid sequence from region 1-176.

Product Specifications

Product Name Alternative

Putative sugar uptake protein

UniProt

P60950

Expression Region

1-176

Origin

Lactobacillus delbrueckii subsp. lactis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

IFGEWKTSNNFIFGIXALVIIMVGVIXTXYTEKGDGFTQKTTNKDILFLVLTTXGYLAYX AXPKTITADAESMFLPQTLGILLGSVIYLAFSGNKAAFKEKASYLDLFAGISFGIAAYAY IIXAQVNGVTNAFIYGQLSVIISTIGGMTLLGERKQGKELVATLAGLCLIVVGAIL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GAL4 (LGALS4) (NM_006149) Human Recombinant Protein
TP300026 20 µg

GAL4 (LGALS4) (NM_006149) Human Recombinant Protein

Sign In for Pricing
View Details
Phospho-IKK beta (Ser476) Polyclonal Antibody, PE Conjugated
bs-5442R-PE 100 µL

Phospho-IKK beta (Ser476) Polyclonal Antibody, PE Conjugated

Sign In for Pricing
View Details
ErbB-3 Polyclonal Antibody
JOT-AP03040-01 50ul

ErbB-3 Polyclonal Antibody

Sign In for Pricing
View Details
ErbB-3 Polyclonal Antibody
JOT-AP03040-02 100ul

ErbB-3 Polyclonal Antibody

Sign In for Pricing
View Details
Goat Platelet Derived Growth Factor Subunit B ELISA kit
GTR10447823 96 Well

Goat Platelet Derived Growth Factor Subunit B ELISA kit

Sign In for Pricing
View Details
4930558K02Rik Protein Vector (Mouse) (pPM-C-His)
PV149397 500 ng

4930558K02Rik Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details