Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Disulfide bond formation protein B (dsbB)

This Recombinant Disulfide bond formation protein B (dsbB) spans the amino acid sequence from region 1-176.

Product Specifications

Product Name Alternative

Disulfide bond formation protein B, Disulfide oxidoreductase

UniProt

A1AAA8

Expression Region

1-176

Origin

Escherichia coli O1:K1 / APEC

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLRFLNQCSQGRGAWLLMAFTALALELTALWFQHVMLLKPCVLCIYERCALFGVLGAALI GAIAPKTPLRYVAMVIWLYSAFRGVQLTYEHTMLQLYPSPFATCDFMARFPEWLPLDKWV PQVFVASGDCAERQWEFLGLEMPQWLLGIFIAYLIVAVLVVISQPFKAKKRDLFGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fam115a siRNA Oligos set (Mouse)
19722174 3x 5 nmol

Fam115a siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
ACTR3B, CT (Actin-related Protein 3B, Actin-like Protein 3B, ARP3-beta, Actin-related Protein ARP4, ARP4, ARP11) (MaxLight 490)
MBS6464061-01 0.1 mL

ACTR3B, CT (Actin-related Protein 3B, Actin-like Protein 3B, ARP3-beta, Actin-related Protein ARP4, ARP4, ARP11) (MaxLight 490)

Sign In for Pricing
View Details
ACTR3B, CT (Actin-related Protein 3B, Actin-like Protein 3B, ARP3-beta, Actin-related Protein ARP4, ARP4, ARP11) (MaxLight 490)
MBS6464061-02 5x 0.1 mL

ACTR3B, CT (Actin-related Protein 3B, Actin-like Protein 3B, ARP3-beta, Actin-related Protein ARP4, ARP4, ARP11) (MaxLight 490)

Sign In for Pricing
View Details
Lentiviral human PXDN shRNA (UAS) - Lentiviral human PXDN shRNA (UAS, iRFP) (100)
GTR15340470 1 Vial

Lentiviral human PXDN shRNA (UAS) - Lentiviral human PXDN shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
FAM175A Conjugated Antibody
C46563 100 µL

FAM175A Conjugated Antibody

Sign In for Pricing
View Details
CRMP3 antibody
70R-51703 100 ul

CRMP3 antibody

Sign In for Pricing
View Details