Recombinant Populus trichocarpa NAD (P) H-quinone oxidoreductase subunit 6, chloroplastic
This Recombinant Populus trichocarpa NAD (P) H-quinone oxidoreductase subunit 6, chloroplastic spans the amino acid sequence from region 1-176.
Product Specifications
Product Name Alternative
NAD (P) H-quinone oxidoreductase subunit 6, chloroplastic, EC= 1.6.5.-, NAD (P) H dehydrogenase subunit 6, NADH-plastoquinone oxidoreductase subunit 6
UniProt
A4GYW9
Expression Region
1-176
Origin
Populus trichocarpa (Western balsam poplar) (Populus balsamifera subsp. trichocarpa)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MNLPGPIHDFLLVFLGLGLILGGLGVVLLTNPIFSAFSLGLVLVCISLFYILSNSHFVAA AQLLIYVGAINVLILFAVMFMNGSEYYKDFNLWTVGNGLTSLICTSLFVLLITIISNTTW YGIIWTTRANQIIEQDLVSNGQQIGIHLSTDFFLPFEFISIILLVALIGAIATARQ
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680178-500 1x 500 µL
CD50 (ICAM-3) (186-2G9), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940253-500 1x 500 µL
Cytokeratin, LMW (AE-1), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940844-500 1x 500 µL
Cytokeratin 10 (KRT10/844), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470824-500 1x 500 µL
CD68 (LAMP4/824), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 