Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lepidium virginicum NAD (P) H-quinone oxidoreductase subunit 6, chloroplastic

This Recombinant Lepidium virginicum NAD (P) H-quinone oxidoreductase subunit 6, chloroplastic spans the amino acid sequence from region 1-176.

Product Specifications

Product Name Alternative

NAD (P) H-quinone oxidoreductase subunit 6, chloroplastic, EC= 1.6.5.-, NAD (P) H dehydrogenase subunit 6, NADH-plastoquinone oxidoreductase subunit 6

UniProt

A4QLG2

Expression Region

1-176

Origin

Lepidium virginicum (Virginia pepperweed)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDLPGPIHDFLLVFLGSGLLVGGLGVVLLPNPIFSAFSLGFVLFCISLLYILSNSHFVAA AQLLIYVGAINVLIIFAVMFMNDSEYSTDFNLWTVGNGITSLVCTTILFSLLSTILDTSW YGVIWTTRLNQILEQDLISNSQQIGIHLSTDFFLPFELISIILLVALIGAISVARQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD46 (122.2), CF405S conjugate, 0.1mg/mL
BNC040175-100 1x 100 µL

CD46 (122.2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF740 conjugate, 0.1mg/mL
BNC740806-100 1x 100 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF405S conjugate, 0.1mg/mL
BNC040026-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD54 / ICAM-1 (15.2), CF405S conjugate, 0.1mg/mL
BNC042853-500 1x 500 µL

CD54 / ICAM-1 (15.2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD54 / ICAM-1 (15.2), CF568 conjugate, 0.1mg/mL
BNC682853-500 1x 500 µL

CD54 / ICAM-1 (15.2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BOB.1 (B-Cell Marker) (BOB1/2422), CF488A conjugate, 0.1mg/mL
BNC882422-100 1x 100 µL

BOB.1 (B-Cell Marker) (BOB1/2422), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details