Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 97 (TMEM97)

This Recombinant Human Transmembrane protein 97 (TMEM97) spans the amino acid sequence from region 1-176.

Product Specifications

Product Name Alternative

Transmembrane protein 97, Protein MAC30

UniProt

Q5BJF2

Expression Region

1-176

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGAPATRRCVEWLLGLYFLSHIPITLFMDLQAVLPRELYPVEFRNLLKWYAKEFKDPLLQ EPPAWFKSFLFCELVFQLPFFPIATYAFLKGSCKWIRTPAIIYSVHTMTTLIPILSTFLF EDFSKASGFKGQRPETLHERLTLVSVYAPYLLIPFILLIFMLRSPYYKYEEKRKKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fenspiride Hydrochloride
TRC-F265000-50MG 50 mg

Fenspiride Hydrochloride

Sign In for Pricing
View Details
FGFR2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5F7]
TA502829AM 100 µL

FGFR2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5F7]

Sign In for Pricing
View Details
2,3-Diketogulonic Acid Potassium Salt (Technical Grade)
TRC-D467925-25MG 25 mg

2,3-Diketogulonic Acid Potassium Salt (Technical Grade)

Sign In for Pricing
View Details
Rat Klotho (KL) ELISA Kit
RD-KL-Ra-01 96 Tests

Rat Klotho (KL) ELISA Kit

Sign In for Pricing
View Details
Rat Klotho (KL) ELISA Kit
RD-KL-Ra-02 48 Tests

Rat Klotho (KL) ELISA Kit

Sign In for Pricing
View Details
Retinol Binding Protein-1 (RBP1) (rRBP1/872), CF568 conjugate, 0.1mg/mL
BNC683603-500 1x 500 µL

Retinol Binding Protein-1 (RBP1) (rRBP1/872), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details