Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 97 (Tmem97)

This Recombinant Mouse Transmembrane protein 97 (Tmem97) spans the amino acid sequence from region 1-176.

Product Specifications

Product Name Alternative

Transmembrane protein 97

UniProt

Q8VD00

Expression Region

1-176

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGALAARRCVEWLLGLYFVSHIPITLFIDLQAVLPPELYPQEFSNLLRWYSKEFKDPLMQ EPPVWFKSFLLCELVFQLPFFPIAAYAFFKGSCRWIRIPAIIYAAHTITTLIPILYTLLF EDFSKAVAFKGQRPESFRERLTLVGVYAPYLIIPLILLLFMLRNPYYKYEEKRKKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phenylsilane
TRC-P336775-25G 25 g

Phenylsilane

Sign In for Pricing
View Details
ETS1 / (Marker of Tumor Metastasis) (ETS1/1282), Biotin conjugate, 0.1mg/mL
BNCB1282-100 1x 100 µL

ETS1 / (Marker of Tumor Metastasis) (ETS1/1282), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Laboratory Water Purification System BLPS-301
BLPS-301 1 Unit

Laboratory Water Purification System BLPS-301

Sign In for Pricing
View Details
Rgcc Mouse Gene Knockout Kit (CRISPR)
KN514717 1 Kit

Rgcc Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SIRT1 Human Gene Knockout Kit (CRISPR)
KN218134RB 1 Kit

SIRT1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
LILRA1 (NM_001278318) Human Tagged ORF Clone
RG237224 10 µg

LILRA1 (NM_001278318) Human Tagged ORF Clone

Sign In for Pricing
View Details