Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 97 (Tmem97)

This Recombinant Mouse Transmembrane protein 97 (Tmem97) spans the amino acid sequence from region 1-176.

Product Specifications

Product Name Alternative

Transmembrane protein 97

UniProt

Q8VD00

Expression Region

1-176

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGALAARRCVEWLLGLYFVSHIPITLFIDLQAVLPPELYPQEFSNLLRWYSKEFKDPLMQ EPPVWFKSFLLCELVFQLPFFPIAAYAFFKGSCRWIRIPAIIYAAHTITTLIPILYTLLF EDFSKAVAFKGQRPESFRERLTLVGVYAPYLIIPLILLLFMLRNPYYKYEEKRKKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pyriproxyfen-D4
TRC-P998852-1MG 1 mg

Pyriproxyfen-D4

Sign In for Pricing
View Details
Gamma-Cyclodextrin Deuterated
TRC-C989097-2.5MG 2.5 mg

Gamma-Cyclodextrin Deuterated

Sign In for Pricing
View Details
RN 1734
TRC-R637005-250MG 250 mg

RN 1734

Sign In for Pricing
View Details
ATRX Antibody
KC-2473-01 50 μL

ATRX Antibody

Sign In for Pricing
View Details
ATRX Antibody
KC-2473-02 100 µL

ATRX Antibody

Sign In for Pricing
View Details
ATRX Antibody
KC-2473-03 1 mL

ATRX Antibody

Sign In for Pricing
View Details