Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant V-type proton ATPase 16 kDa proteolipid subunit (VMA3)

This Recombinant V-type proton ATPase 16 kDa proteolipid subunit (VMA3) spans the amino acid sequence from region 1-176.

Product Specifications

Product Name Alternative

V-type proton ATPase 16 kDa proteolipid subunit, V-ATPase 16 kDa proteolipid subunit, Vacuolar proton pump 16 kDa proteolipid subunit

UniProt

Q24808

Expression Region

1-176

Origin

Entamoeba dispar

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSVLLRSVTELCPVYSPFFGSMGITASIVFTVFGGAYGTAKSSVGISSVGVMKPEFIMRS LFPVVFAGVIGLYGLIVCIVLFINVNKSEYSLNRAFLDLGAGLTCGLCGLASGMSIGISG DCGVRGAAQQPKLFVSMLICLIFSEALALYGFIVALIMAATGDNSCVATASTSSSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNF182 Human Over-expression Lysate
orb1339682 100 µg

RNF182 Human Over-expression Lysate

Sign In for Pricing
View Details
MC2R sgRNA CRISPR Lentivector set (Human)
K1276901 3x 1.0 µg

MC2R sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Biotin anti-human CD3
E16FHB003-100U 100 µg

Biotin anti-human CD3

Sign In for Pricing
View Details
Fucokinase (F-9) HRP
sc-377371 HRP 200 µg/mL

Fucokinase (F-9) HRP

Sign In for Pricing
View Details
Monkey Signal Transducer and Activator of Transcription 1 (STAT1) ELISA Kit
abx358711 96 Well

Monkey Signal Transducer and Activator of Transcription 1 (STAT1) ELISA Kit

Sign In for Pricing
View Details
CDSN Polyclonal Conjugated Antibody
orb1627884 100 µL

CDSN Polyclonal Conjugated Antibody

Sign In for Pricing
View Details