Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant V-type proton ATPase 16 kDa proteolipid subunit (VMA3)

This Recombinant V-type proton ATPase 16 kDa proteolipid subunit (VMA3) spans the amino acid sequence from region 1-176.

Product Specifications

Product Name Alternative

V-type proton ATPase 16 kDa proteolipid subunit, V-ATPase 16 kDa proteolipid subunit, Vacuolar proton pump 16 kDa proteolipid subunit

UniProt

Q24808

Expression Region

1-176

Origin

Entamoeba dispar

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSVLLRSVTELCPVYSPFFGSMGITASIVFTVFGGAYGTAKSSVGISSVGVMKPEFIMRS LFPVVFAGVIGLYGLIVCIVLFINVNKSEYSLNRAFLDLGAGLTCGLCGLASGMSIGISG DCGVRGAAQQPKLFVSMLICLIFSEALALYGFIVALIMAATGDNSCVATASTSSSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RP11-529I10.4 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV810835 1.0 µg DNA

RP11-529I10.4 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
GPR171 Antibody
orb1423684 100 µL

GPR171 Antibody

Sign In for Pricing
View Details
N-Acetyl Amonafide
TRC-A168300-5MG 5 mg

N-Acetyl Amonafide

Sign In for Pricing
View Details
Methyl 3-ethynylpyridine-2-carboxylate
WXB15666-01 50 mg

Methyl 3-ethynylpyridine-2-carboxylate

Sign In for Pricing
View Details
Methyl 3-ethynylpyridine-2-carboxylate
WXB15666-02 0.5 g

Methyl 3-ethynylpyridine-2-carboxylate

Sign In for Pricing
View Details
Rabbit Polyclonal TNP1 Antibody
NBP2-30567-25ul 25 µL

Rabbit Polyclonal TNP1 Antibody

Sign In for Pricing
View Details