Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Eumops glaucinus Cytochrome b (MT-CYB)

This Recombinant Eumops glaucinus Cytochrome b (MT-CYB) spans the amino acid sequence from region 1-176.

Product Specifications

Product Name Alternative

Cytochrome b, Complex III subunit 3, Complex III subunit III, Cytochrome b-c1 complex subunit 3, Ubiquinol-cytochrome-c reductase complex cytochrome b subunit

UniProt

Q34462

Expression Region

1-176

Origin

Eumops glaucinus (Wagner's mastiff bat) (Wagner's bonneted bat)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTNIRKSHPLIKIVNDAFIDLPAPSNISSWWNFGSLLGICLAVQILTGLFLAMHYTSDTA TAFNSVTHICRDVNYGWLLRYLHANGASMFFICLYLHIGRGLYYGSYTYTETWNVGVILL FAVMATAFMGYVLPWGQMSSWGATVITNLLSAIPYMGTDLVGWIWGGFSVDKATLT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Vitamin E (VE) ELISA Kit
QY-E01059 96 Tests

Human Vitamin E (VE) ELISA Kit

Sign In for Pricing
View Details
Mouse CD44 ELISA Kit
orb385366 96 Tests

Mouse CD44 ELISA Kit

Sign In for Pricing
View Details
LOC689064 AAV Vector (Rat) (CMV)
27448106 1 µg

LOC689064 AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details
Spirotetramat metabolite byi08330-mono-hydroxy
XWB13412-01 25 mg

Spirotetramat metabolite byi08330-mono-hydroxy

Sign In for Pricing
View Details
Spirotetramat metabolite byi08330-mono-hydroxy
XWB13412-02 50 mg

Spirotetramat metabolite byi08330-mono-hydroxy

Sign In for Pricing
View Details
Spirotetramat metabolite byi08330-mono-hydroxy
XWB13412-03 100 mg

Spirotetramat metabolite byi08330-mono-hydroxy

Sign In for Pricing
View Details