Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Psychrobacter arcticus Disulfide bond formation protein B (dsbB)

This Recombinant Psychrobacter arcticus Disulfide bond formation protein B (dsbB) spans the amino acid sequence from region 1-176.

Product Specifications

Product Name Alternative

Disulfide bond formation protein B, Disulfide oxidoreductase

UniProt

Q4FVQ0

Expression Region

1-176

Origin

Psychrobacter arcticus (strain DSM 17307 / 273-4)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLQLTTYRNLQVFLVIMTAIGMSFALFFLQRYMGFSPCPLCIFQRIGLMIMGGFALIAAL FHPKSMVIRLLLWLGSLAGIGWAAIVAGRHVWLQHLPADQVPSCGPGLDYWLDTLPMQQV LKEVFAGSGECASIEWTFLGLSIPEQSLILFSILILTHLLILWRIVRPSTPKPLAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-tert-Butyl-1,4-benzoquinone
TRC-B700575-250MG 250 mg

2-tert-Butyl-1,4-benzoquinone

Sign In for Pricing
View Details
Recombinant Pseudozyma antarctica Lipase B/CALB Protein, C-His
AP96874 50 µg

Recombinant Pseudozyma antarctica Lipase B/CALB Protein, C-His

Sign In for Pricing
View Details
Titin/Connectin Human Monoclonal Antibody
orb2956498-01 50 µg

Titin/Connectin Human Monoclonal Antibody

Sign In for Pricing
View Details
Titin/Connectin Human Monoclonal Antibody
orb2956498-02 100 µg

Titin/Connectin Human Monoclonal Antibody

Sign In for Pricing
View Details
Titin/Connectin Human Monoclonal Antibody
orb2956498-03 1 mg

Titin/Connectin Human Monoclonal Antibody

Sign In for Pricing
View Details
DcR3 Polyclonal Antibody
UB-GEN-12989 100 µL

DcR3 Polyclonal Antibody

Sign In for Pricing
View Details