Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Protein Mpv17 (Mpv17)

This Recombinant Rat Protein Mpv17 (Mpv17) spans the amino acid sequence from region 1-176.

Product Specifications

Product Name Alternative

Protein Mpv17

UniProt

Q5BK62

Expression Region

1-176

Origin

Rattus norvegicus (Rat)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MALWRAYQRALAAHPWKVQVLTAGSLMGLGDIISQQLVERRGLQQHQTGRTLTMASLGCG FVGPVVGGWYRVLDHLIPGTTKVNALKKMLLDQGGFAPCFLGCFLPLVGVLNGMSAQDNW AKLKRDYPDALITNYYLWPAVQLANFYLVPLHYRLAVVQCVAVVWNSYLSWKAHQL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PXN ELISA Kit (Mouse)
OKCD02782-96W 96 Well

PXN ELISA Kit (Mouse)

Sign In for Pricing
View Details
Compound Fr13961
Fr13961-01 1 g

Compound Fr13961

Sign In for Pricing
View Details
Compound Fr13961
Fr13961-02 100 mg

Compound Fr13961

Sign In for Pricing
View Details
Compound Fr13961
Fr13961-03 500 mg

Compound Fr13961

Sign In for Pricing
View Details
Mouse Monoclonal MSPR/Ron Antibody (CL0463)
NBP2-30924-25ul 25 µL

Mouse Monoclonal MSPR/Ron Antibody (CL0463)

Sign In for Pricing
View Details
Prolactin Receptor (CPRLP, hPRL receptor, hPRLrI, Lactogen receptor, OPR, Pr-1, Pr-3, PRL-R, Prolactin receptor delta 7/11, RATPRLR, Secreted prolactin binding Protein, Truncated testis-specific box 1-C prolactin receptor) (PE)
172143-AF-PE 100 µL

Prolactin Receptor (CPRLP, hPRL receptor, hPRLrI, Lactogen receptor, OPR, Pr-1, Pr-3, PRL-R, Prolactin receptor delta 7/11, RATPRLR, Secreted prolactin binding Protein, Truncated testis-specific box 1-C prolactin receptor) (PE)

Sign In for Pricing
View Details