Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Disulfide bond formation protein B (dsbB)

This Recombinant Disulfide bond formation protein B (dsbB) spans the amino acid sequence from region 1-176.

Product Specifications

Product Name Alternative

Disulfide bond formation protein B, Disulfide oxidoreductase

UniProt

Q8ZEM1

Expression Region

1-176

Origin

Yersinia pestis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLQFLNRCSRGRGAWLLMALTAFLLELTALYFQHIMLLQPCVMCIYERVALFGILGASLL GAIAPRSPLRYLAIAVWIYSAWKGVQLAWAHTMLQLNPSPFNTCDFFVNFPSWLPLDKWL PAVFAASGDCSERQWQFMSLEMPQWLVGIFAAYLVIAVLVLISQFVKPKRRDLFGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Indole-3-acetonitrile
TRC-I577355-5G 5 g

Indole-3-acetonitrile

Sign In for Pricing
View Details
2-Nitrobenzoic Acid
TRC-N493515-5G 5 g

2-Nitrobenzoic Acid

Sign In for Pricing
View Details
TAX1BP3 Antibody
KC-43900-01 50 μL

TAX1BP3 Antibody

Sign In for Pricing
View Details
TAX1BP3 Antibody
KC-43900-02 100 µL

TAX1BP3 Antibody

Sign In for Pricing
View Details
TAX1BP3 Antibody
KC-43900-03 1 mL

TAX1BP3 Antibody

Sign In for Pricing
View Details
Recombinant Human RHEB Protein (His Tag)
PKSH031137 100 µg

Recombinant Human RHEB Protein (His Tag)

Sign In for Pricing
View Details