Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Probable cytochrome b561 (cybB)

This Recombinant Probable cytochrome b561 (cybB) spans the amino acid sequence from region 1-176.

Product Specifications

Product Name Alternative

Probable cytochrome b561, Cytochrome b-561

UniProt

Q9X6B2

Expression Region

1-176

Origin

Yersinia pestis

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHKKYSCLQIGIHWLVLLLVIIAWSSIELRGFAPRSYQPWMKMIHFSCGIAILVLMMTRI LIQLRYPTPPIVPKPSPMIVGLAHVGHWVIYLLFIALPIIGIAILYCRGSSWIAFGLIMP HAEQANFDLADTLKAYHLLLANMSYFVIGLHALAALLHHYVLKDNTLLRMMPKKRG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SH2D4A Protein Vector (Human) (pPB-C-His)
PV057693 500 ng

SH2D4A Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Anti-Human PSAP antibody
STJ16100420 1 mL

Anti-Human PSAP antibody

Sign In for Pricing
View Details
Recombinant Shigella Boydii lptE Protein (aa 19-193) (strain Sb227)
VAng-Lsx08682-1mgEcoli 1 mg (E. coli)

Recombinant Shigella Boydii lptE Protein (aa 19-193) (strain Sb227)

Sign In for Pricing
View Details
Cochlin (COCH) Antibody
abx005036-01 60 µL

Cochlin (COCH) Antibody

Sign In for Pricing
View Details
Cochlin (COCH) Antibody
abx005036-02 120 µL

Cochlin (COCH) Antibody

Sign In for Pricing
View Details
Cochlin (COCH) Antibody
abx005036-03 200 µL

Cochlin (COCH) Antibody

Sign In for Pricing
View Details