What is the catalog number for Recombinant Probable cytochrome b561 (cybB)?

The catalog number for Recombinant Probable cytochrome b561 (cybB) is orb2919711.

What sizes are available for Recombinant Probable cytochrome b561 (cybB)?

Recombinant Probable cytochrome b561 (cybB) is available in the following size(s): 20 µg, 100 µg.

How many pack sizes does Recombinant Probable cytochrome b561 (cybB) come in?

Recombinant Probable cytochrome b561 (cybB) is available in 2 different pack sizes.

Is Recombinant Probable cytochrome b561 (cybB) in stock?

Recombinant Probable cytochrome b561 (cybB) is currently made to order / not held in immediate stock. Contact us for lead time.

Recombinant Probable cytochrome b561 (cybB)

This Recombinant Probable cytochrome b561 (cybB) spans the amino acid sequence from region 1-176.

Product Specifications

Product Name Alternative

Probable cytochrome b561, Cytochrome b-561

UniProt

Q9X6B2

Expression Region

1-176

Origin

Yersinia pestis

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHKKYSCLQIGIHWLVLLLVIIAWSSIELRGFAPRSYQPWMKMIHFSCGIAILVLMMTRI LIQLRYPTPPIVPKPSPMIVGLAHVGHWVIYLLFIALPIIGIAILYCRGSSWIAFGLIMP HAEQANFDLADTLKAYHLLLANMSYFVIGLHALAALLHHYVLKDNTLLRMMPKKRG