Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Protein Mpv17 (Mpv17)

This Recombinant Mouse Protein Mpv17 (Mpv17) spans the amino acid sequence from region 1-176.

Product Specifications

Product Name Alternative

Protein Mpv17, Mpv-17

UniProt

P19258

Expression Region

1-176

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MALWRAYQRALAAHPWKVQVLTAGSLMGVGDMISQQLVERRGLQQHQAGRTLTMVSLGCG FVGPVVGGWYKVLDHLIPGTTKVHALKKMLLDQGGFAPCFLGCFLPLVGILNGMSAQDNW AKLKRDYPDALITNYYLWPAVQLANFYLVPLHYRLAVVQCVAIVWNSYLSWKAHQF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EEF1A2 Rabbit Polyclonal Antibody (Cy7)
orb1059087 100 µL

EEF1A2 Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details
Human CSNK2B (Casein Kinase 2, beta) ELISA Kit
MBS2515961-01 24 Tests

Human CSNK2B (Casein Kinase 2, beta) ELISA Kit

Sign In for Pricing
View Details
Human CSNK2B (Casein Kinase 2, beta) ELISA Kit
MBS2515961-02 48 Test

Human CSNK2B (Casein Kinase 2, beta) ELISA Kit

Sign In for Pricing
View Details
Human CSNK2B (Casein Kinase 2, beta) ELISA Kit
MBS2515961-03 96 Tests

Human CSNK2B (Casein Kinase 2, beta) ELISA Kit

Sign In for Pricing
View Details
Human CSNK2B (Casein Kinase 2, beta) ELISA Kit
MBS2515961-04 5x 96 Tests

Human CSNK2B (Casein Kinase 2, beta) ELISA Kit

Sign In for Pricing
View Details
Human CSNK2B (Casein Kinase 2, beta) ELISA Kit
MBS2515961-05 10x 96 Tests

Human CSNK2B (Casein Kinase 2, beta) ELISA Kit

Sign In for Pricing
View Details