Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cytochrome b561 (cybB)

This Recombinant Cytochrome b561 (cybB) spans the amino acid sequence from region 1-176.

Product Specifications

Product Name Alternative

Cytochrome b561, Cytochrome b-561

UniProt

P0ABE6

Expression Region

1-176

Origin

Shigella flexneri

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENKYSRLQISIHWLVFLLVIAAYCAMEFRGFFPRSDRPLINMIHVSCGISILVLMVVRL LLRLKYPTPPIIPKPKPMMTGLAHLGHLVIYLLFIALPVIGLVMMYNRGNPWFAFGLTMP YASEANFERVDSLKSWHETLANLGYFVIGLHAAAALAHHYFWKDNTLLRMMPRKRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PROX1 (723-727) Rabbit Polyclonal Antibody
AP26049PU-S 50 µL

PROX1 (723-727) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SH3TC1 Human Gene Knockout Kit (CRISPR)
KN416734 1 Kit

SH3TC1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SPCS1 Human Gene Knockout Kit (CRISPR)
KN401472 1 Kit

SPCS1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mono(n-pentyl) Terephthalate
TRC-M566603-25MG 25 mg

Mono(n-pentyl) Terephthalate

Sign In for Pricing
View Details
OR2G6 (NM_001013355) Human Over-expression Lysate
LY422962 100 µg

OR2G6 (NM_001013355) Human Over-expression Lysate

Sign In for Pricing
View Details
Perilipin 3 (PLIN3) Human Gene Knockout Kit (CRISPR)
KN401193 1 Kit

Perilipin 3 (PLIN3) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details