Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum Probable intracellular septation protein A (BU275)

This Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum Probable intracellular septation protein A (BU275) spans the amino acid sequence from region 1-177.

Product Specifications

Product Name Alternative

Probable intracellular septation protein A

UniProt

P57363

Expression Region

1-177

Origin

Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) (Acyrthosiphon pisum symbiotic bacterium)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKQILNILPMFIFFIFYKFYDIFIASGSLIVISGLICIIHWIFYNEIDKISLFSFLSVFF FGSLTIFFHNSQFIKWKITIIYIIFSLVLLISQFFTRKPMIQRFLEKDIKISNIYWRKIN FIWSLFFLFCAILNIYIAYYFSETIWVNFKVFGFTSLTFFLILITSIYINCKISKNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45 / LCA (2B11 + PD7/26), CF594 conjugate, 0.1mg/mL
BNC940745-500 1x 500 µL

CD45 / LCA (2B11 + PD7/26), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 / ICAM3 (CG106), CF568 conjugate, 0.1mg/mL
BNC682216-100 1x 100 µL

CD50 / ICAM3 (CG106), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A (CGA/414), CF488A conjugate, 0.1mg/mL
BNC880414-500 1x 500 µL

Chromogranin A (CGA/414), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (GP1.4 + E29), CF740 conjugate, 0.1mg/mL
BNC740743-500 1x 500 µL

Mucin 1 / EMA / Episialin / CD227 (GP1.4 + E29), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 19 (Pancreatic Stem Cell Marker) (rKRT19/800), CF488A conjugate, 0.1mg/mL
BNC881958-100 1x 100 µL

Cytokeratin 19 (Pancreatic Stem Cell Marker) (rKRT19/800), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TLE1 (Synovial Sarcoma Marker) (TLE1/2051), CF488A conjugate, 0.1mg/mL
BNC882051-100 1x 100 µL

TLE1 (Synovial Sarcoma Marker) (TLE1/2051), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details