Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Verminephrobacter eiseniae Disulfide bond formation protein B (dsbB)

This Recombinant Verminephrobacter eiseniae Disulfide bond formation protein B (dsbB) spans the amino acid sequence from region 1-177.

Product Specifications

Product Name Alternative

Disulfide bond formation protein B, Disulfide oxidoreductase

UniProt

A1WG92

Expression Region

1-177

Origin

Verminephrobacter eiseniae (strain EF01-2)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMVWNWIDRTPRRVLALISLACVALLACGLYLQHVVGLVPCPMCIVQRYALIGLALLTGL ASARSAKGWWLTLSALAALTAGFGATVAARQSWLQWYPPQSVSCGRDFYGMIESFPLSRA IPMILRGSGDCAAVDWSLLGGSIANWSFLCFALLGLLLLALLARGVRGARQRAPAPV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPR17 Antibody
8G142-AAT 50 µg

GPR17 Antibody

Sign In for Pricing
View Details
RNH1 Antibody
KC-31730-01 50 μL

RNH1 Antibody

Sign In for Pricing
View Details
RNH1 Antibody
KC-31730-02 100 µL

RNH1 Antibody

Sign In for Pricing
View Details
RNH1 Antibody
KC-31730-03 1 mL

RNH1 Antibody

Sign In for Pricing
View Details
Benzo[b]fluoren-11-one
TRC-B411240-50MG 50 mg

Benzo[b]fluoren-11-one

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary: bilateral
CS800320 5x 5 µm

Tissue FFPE Sections, Ovary: bilateral

Sign In for Pricing
View Details