Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Verminephrobacter eiseniae Disulfide bond formation protein B (dsbB)

This Recombinant Verminephrobacter eiseniae Disulfide bond formation protein B (dsbB) spans the amino acid sequence from region 1-177.

Product Specifications

Product Name Alternative

Disulfide bond formation protein B, Disulfide oxidoreductase

UniProt

A1WG92

Expression Region

1-177

Origin

Verminephrobacter eiseniae (strain EF01-2)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMVWNWIDRTPRRVLALISLACVALLACGLYLQHVVGLVPCPMCIVQRYALIGLALLTGL ASARSAKGWWLTLSALAALTAGFGATVAARQSWLQWYPPQSVSCGRDFYGMIESFPLSRA IPMILRGSGDCAAVDWSLLGGSIANWSFLCFALLGLLLLALLARGVRGARQRAPAPV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Cyclin B3 (CCNB3) activation kit by CRISPRa
GA113878 1 Kit

Human Cyclin B3 (CCNB3) activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Blocks, Testis
CB525159 1 Block

Frozen Tissue Blocks, Testis

Sign In for Pricing
View Details
HCG-beta (hCGb/459), CF640R conjugate, 0.1mg/mL
BNC400211-100 1x 100 µL

HCG-beta (hCGb/459), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human PPP5D1P activation kit by CRISPRa
GA119289 1 Kit

Human PPP5D1P activation kit by CRISPRa

Sign In for Pricing
View Details
Usp50 Mouse Gene Knockout Kit (CRISPR)
KN518809 1 Kit

Usp50 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
EPO-R Rabbit Polyclonal Antibody
HA500529 100 µL

EPO-R Rabbit Polyclonal Antibody

Sign In for Pricing
View Details