Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Putative lipid phosphate phosphatase yodM (yodM)

This Recombinant Bacillus subtilis Putative lipid phosphate phosphatase yodM (yodM) spans the amino acid sequence from region 27-203.

Product Specifications

Product Name Alternative

Putative lipid phosphate phosphatase yodM, EC= 3.1.3.-

UniProt

O34349

Expression Region

27-203

Origin

Bacillus subtilis (strain 168)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

DEAISKAAVLIRQPWLNEVMTGITHLGASSFLLPLIVIIGAGMFFYRKTWDGLLMLLVFG TDRLLNKVLKEWIERVRPDFAPLVHESSFSFPSGHSMNAACVYPVIAYFLVKHLPFLSKH KKMVYIIAGVIAVLVGISRVYLGVHFVTDVLGGFSLGLLLFFLVKGFDEKIKRFRQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZL0454
BA4706-1 1 mg

ZL0454

Sign In for Pricing
View Details
DFNB31 (Center) Rabbit pAb
MBS8551431-01 0.1 mL

DFNB31 (Center) Rabbit pAb

Sign In for Pricing
View Details
DFNB31 (Center) Rabbit pAb
MBS8551431-02 0.1 mL (AF405L)

DFNB31 (Center) Rabbit pAb

Sign In for Pricing
View Details
DFNB31 (Center) Rabbit pAb
MBS8551431-03 0.1 mL (AF405S)

DFNB31 (Center) Rabbit pAb

Sign In for Pricing
View Details
DFNB31 (Center) Rabbit pAb
MBS8551431-04 0.1 mL (AF610)

DFNB31 (Center) Rabbit pAb

Sign In for Pricing
View Details
DFNB31 (Center) Rabbit pAb
MBS8551431-05 0.1 mL (AF635)

DFNB31 (Center) Rabbit pAb

Sign In for Pricing
View Details