Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1644 (MJ1644)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1644 (MJ1644) spans the amino acid sequence from region 1-177.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ1644

UniProt

Q59038

Expression Region

1-177

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIKMELKEAKYLGGIGAVLNLVSYAVGGILAIAGYVLILLALNKISKIFNDDEVFKKYLY GVVLWIIAVLIVIFAVGISFVSLSFIPLDYGLTAMSSFLVGVILFYILSVIGGYFIKKSY EKVSYYTGVDSFRICGLLYFIGTLLLIVIVGIIVIIVAQILEIVAYFSLPDDLKSEN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACKR3 (C-term) Goat Polyclonal Antibody
AP33489PU-N 100 µg

ACKR3 (C-term) Goat Polyclonal Antibody

Sign In for Pricing
View Details
MGAT4A (NM_001160154) Human Over-expression Lysate
LC431368 20 µg

MGAT4A (NM_001160154) Human Over-expression Lysate

Sign In for Pricing
View Details
CD253 Antibody
8C10669-AAT 50 µg

CD253 Antibody

Sign In for Pricing
View Details
CD74 Antibody
KC-1112-01 50 μL

CD74 Antibody

Sign In for Pricing
View Details
CD74 Antibody
KC-1112-02 100 µL

CD74 Antibody

Sign In for Pricing
View Details
CD74 Antibody
KC-1112-03 1 mL

CD74 Antibody

Sign In for Pricing
View Details