Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1644 (MJ1644)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1644 (MJ1644) spans the amino acid sequence from region 1-177.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ1644

UniProt

Q59038

Expression Region

1-177

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIKMELKEAKYLGGIGAVLNLVSYAVGGILAIAGYVLILLALNKISKIFNDDEVFKKYLY GVVLWIIAVLIVIFAVGISFVSLSFIPLDYGLTAMSSFLVGVILFYILSVIGGYFIKKSY EKVSYYTGVDSFRICGLLYFIGTLLLIVIVGIIVIIVAQILEIVAYFSLPDDLKSEN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Ethoxyethyl Acetate
TRC-E678260-5ML 5 mL

2-Ethoxyethyl Acetate

Sign In for Pricing
View Details
CIB1 Mouse Monoclonal Antibody [Clone ID: OTI1B8]
CF811147 100 µg

CIB1 Mouse Monoclonal Antibody [Clone ID: OTI1B8]

Sign In for Pricing
View Details
Basic Red 46, Technical Grade
TRC-B118733-25MG 25 mg

Basic Red 46, Technical Grade

Sign In for Pricing
View Details
Mouse Procollagen I C-Terminal Propeptide (PICP) ELISA Kit
RDR-PICP-Mu-01 96 Tests

Mouse Procollagen I C-Terminal Propeptide (PICP) ELISA Kit

Sign In for Pricing
View Details
Mouse Procollagen I C-Terminal Propeptide (PICP) ELISA Kit
RDR-PICP-Mu-02 48 Tests

Mouse Procollagen I C-Terminal Propeptide (PICP) ELISA Kit

Sign In for Pricing
View Details
TGFB1 Antibody
KC-4082-01 50 μL

TGFB1 Antibody

Sign In for Pricing
View Details