Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1644 (MJ1644)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1644 (MJ1644) spans the amino acid sequence from region 1-177.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ1644

UniProt

Q59038

Expression Region

1-177

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIKMELKEAKYLGGIGAVLNLVSYAVGGILAIAGYVLILLALNKISKIFNDDEVFKKYLY GVVLWIIAVLIVIFAVGISFVSLSFIPLDYGLTAMSSFLVGVILFYILSVIGGYFIKKSY EKVSYYTGVDSFRICGLLYFIGTLLLIVIVGIIVIIVAQILEIVAYFSLPDDLKSEN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC653994 Human Gene Knockout Kit (CRISPR)
KN402945 1 Kit

LOC653994 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MANBAL (NM_001003897) Human Over-expression Lysate
LC424033 20 µg

MANBAL (NM_001003897) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS501514 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
ZFPL1 (NM_006782) Human Over-expression Lysate
LY402028 100 µg

ZFPL1 (NM_006782) Human Over-expression Lysate

Sign In for Pricing
View Details
PKC-beta 1 Antibody
KC-1421-01 50 μL

PKC-beta 1 Antibody

Sign In for Pricing
View Details
PKC-beta 1 Antibody
KC-1421-02 100 µL

PKC-beta 1 Antibody

Sign In for Pricing
View Details