Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xenopus laevis Protein Mpv17 (mpv17)

This Recombinant Xenopus laevis Protein Mpv17 (mpv17) spans the amino acid sequence from region 1-177.

Product Specifications

Product Name Alternative

Protein Mpv17

UniProt

Q66GV0

Expression Region

1-177

Origin

Xenopus laevis (African clawed frog)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGLWRAYQRLLGAHPWKVQIVTAGSLVGVGDVISQQLLERKGLKGHSIERTVKMMGIGF CFVGPVVGGWYKILDRIIPGSGKPVALKKMLLDQVAFAPCFLGCFLSIASALNGLSGEQI WGKLKRDYKDALITNYYIWPAVQVANFYFIPLYHRLAVVQFVAIIWNSYLSWKANKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF640R conjugate, 0.1mg/mL
BNC401073-100 1x 100 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF594 conjugate, 0.1mg/mL
BNC940645-100 1x 100 µL

FOXP3 (3G3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNFS15 / VEGI (Vascular Endothelial Growth Inhibitor) (VEGI/2052R), CF568 conjugate, 0.1mg/mL
BNC682052-100 1x 100 µL

TNFS15 / VEGI (Vascular Endothelial Growth Inhibitor) (VEGI/2052R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD79a (IGA/1688R), CF594 conjugate, 0.1mg/mL
BNC941688-100 1x 100 µL

CD79a (IGA/1688R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC2 (Mucin 2) (MLP/2970R), CF594 conjugate, 0.1mg/mL
BNC942970-500 1x 500 µL

MUC2 (Mucin 2) (MLP/2970R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 10 (KRT10) (Suprabasal Epithelial Marker) (rKRT10/844), CF488A conjugate, 0.1mg/mL
BNC881989-100 1x 100 µL

Cytokeratin 10 (KRT10) (Suprabasal Epithelial Marker) (rKRT10/844), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details