Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Protein Mpv17 (mpv17)

This Recombinant Danio rerio Protein Mpv17 (mpv17) spans the amino acid sequence from region 1-177.

Product Specifications

Product Name Alternative

Protein Mpv17

UniProt

Q5TZ51

Expression Region

1-177

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGLWRSYQALMAKHPWKVQIITAGSLVGVGDVISQQLIERRGLANHNARRTAKMMSIGF FFVGPVVGGWYKVLDKLVTGGTKSAALKKMLVDQVGFAPCFLGAFLGITGTLNGLTVEEN VAKLQRDYTDALISNYYLWPPVQIANFYFIPLHHRLAVVQIVAVVWNSYLSWKANKM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LINC02872 (NM_001001709) Human Over-expression Lysate
LC424214 20 µg

LINC02872 (NM_001001709) Human Over-expression Lysate

Sign In for Pricing
View Details
LCN6 (NM_198946) Human Over-expression Lysate
LC403700 20 µg

LCN6 (NM_198946) Human Over-expression Lysate

Sign In for Pricing
View Details
CD59 Rabbit Polyclonal Antibody
TA371292 100 µL

CD59 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Fresolimumab Biosimilar - Research Grade
ICH5077-20mg 20 mg

Fresolimumab Biosimilar - Research Grade

Sign In for Pricing
View Details
Cyclin E (G1/S-Phase Cyclin) (CCNE1/2460), CF640R conjugate, 0.1mg/mL
BNC402460-500 1x 500 µL

Cyclin E (G1/S-Phase Cyclin) (CCNE1/2460), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-9E3), CF488A conjugate, 0.1mg/mL
BNC880010-100 1x 100 µL

MART-1 / Melan-A (M2-9E3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details