Recombinant Chromobacterium violaceum Probable intracellular septation protein A (CV_2929)
This Recombinant Chromobacterium violaceum Probable intracellular septation protein A (CV_2929) spans the amino acid sequence from region 1-177.
Product Specifications
Product Name Alternative
Probable intracellular septation protein A
UniProt
Q7NTX4
Expression Region
1-177
Origin
Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MKFFTDLLPVLLFFGAYWLTRDMFVATGVAIAATAVMVAWAWFKHRKVDTMQWISLGLIV VLGGATLLLHDKHFIMWKPTVLYWVMGAGLLISEFAGKNGLRLMMGKQIEMPDPVWRKLT WAWSGFFAFMGALNLFVAYHFSEDVWVNFKLFGGMGLMLLFVIAQSLFLAKYIEEKK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680218-500 1x 500 µL
CD100 (Semaphorin-4D) (A8), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740040-100 1x 100 µL
CD35 / CR1 (E11), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880270-500 1x 500 µL
Fibronectin (HFN7.1), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details