Recombinant Bacillus subtilis Uncharacterized transmembrane protein yshB (yshB)
This Recombinant Bacillus subtilis Uncharacterized transmembrane protein yshB (yshB) spans the amino acid sequence from region 1-177.
Product Specifications
Product Name Alternative
Uncharacterized transmembrane protein yshB
UniProt
P94543
Expression Region
1-177
Origin
Bacillus subtilis (strain 168)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MLDIIILILLLMGTLLGLKRGFILQFIRLTSFILSIAFAALFYKNVAPHLHWIPAPDFSA GQPALSFFTGNLEAAYYNAIAFIVLFIIAKILLRIIGSFLSIVAGIPVIKQINQMLGAVL GFLEVYLFTFVLLYVASVLPVDALQQMMGQSSLANVIINHTPYLSGLLQELWTQYGA
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6146729-01 0.1 mL
CXCR5 (C-X-C Chemokine Receptor Type 5, CXC-R5, CXCR-5, Burkitt Lymphoma Receptor 1, Monocyte-derived Receptor 15, MDR-15, CD185, BLR1, MDR15) (FITC)
Sign In for Pricing
View Details MBS6146729-02 5x 0.1 mL
CXCR5 (C-X-C Chemokine Receptor Type 5, CXC-R5, CXCR-5, Burkitt Lymphoma Receptor 1, Monocyte-derived Receptor 15, MDR-15, CD185, BLR1, MDR15) (FITC)
Sign In for Pricing
View Details